PDB entry 5bys

View 5bys on RCSB PDB site
Description: Semisynthetic [FeFe]-hydrogenase CpI with sulfur-dithiolato-bridged [2Fe] cofactor
Class: oxidoreductase
Keywords: Hydrogenase, H-cluster, OXIDOREDUCTASE, semisynthetic enzyme
Deposited on 2015-06-10, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29166 (Start-573)
      • expression tag (574-576)
    Domains in SCOPe 2.07: d5bysa1, d5bysa2, d5bysa3, d5bysa4
  • Chain 'B':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bysb1, d5bysb2, d5bysb3
  • Heterogens: SF4, FES, 4WX, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bysA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bysA (A:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkykksaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bysB (B:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bysB (B:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfky