PDB entry 5byr

View 5byr on RCSB PDB site
Description: Semisynthetic [FeFe]-hydrogenase CpI with propane-dithiolato-bridged [2Fe] cofactor
Class: oxidoreductase
Keywords: Hydrogenase, H-cluster, OXIDOREDUCTASE, semisynthetic enzyme
Deposited on 2015-06-10, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5byra1, d5byra2, d5byra3
  • Chain 'B':
    Compound: Iron hydrogenase 1
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5byrb1, d5byrb2, d5byrb3
  • Heterogens: SF4, FES, 4WW, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5byrA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byrA (A:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5byrB (B:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byrB (B:)
    ktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvta
    cdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykaras
    kpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaed
    ekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigelf
    nmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftsccp
    gwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkfe
    adrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgatg
    gvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkfm
    ksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskrk
    shentalvkmyqnyfgkpgegraheilhfkyk