PDB entry 5bxh

View 5bxh on RCSB PDB site
Description: Crystal structure of pentameric KCTD9 BTB domain
Class: protein binding
Keywords: protein binding
Deposited on 2015-06-08, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BTB/POZ domain-containing protein KCTD9
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L273 (3-105)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxha1, d5bxha2
  • Chain 'B':
    Compound: BTB/POZ domain-containing protein KCTD9
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L273 (3-105)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxhb1, d5bxhb2
  • Chain 'C':
    Compound: BTB/POZ domain-containing protein KCTD9
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L273 (3-105)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxhc1, d5bxhc2
  • Chain 'D':
    Compound: BTB/POZ domain-containing protein KCTD9
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7L273 (3-105)
      • expression tag (2)
    Domains in SCOPe 2.07: d5bxhd1, d5bxhd2
  • Chain 'E':
    Compound: BTB/POZ domain-containing protein KCTD9
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bxhe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bxhA (A:)
    snadwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyf
    epilnylrhgqlivndginllgvleearffgidsliehlevaikns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxhA (A:)
    nadwltlnvggryftttrstlvnkepdsmlahmfkdgnkqdhrgaflidrspeyfepiln
    ylrhgqlivndginllgvleearffgidsliehlevaikns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bxhB (B:)
    snadwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyf
    epilnylrhgqlivndginllgvleearffgidsliehlevaikns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxhB (B:)
    nadwltlnvggryftttrstlvnkepdsmlahmfknkqdhrgaflidrspeyfepilnyl
    rhgqlivndginllgvleearffgidsliehlevaikns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bxhC (C:)
    snadwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyf
    epilnylrhgqlivndginllgvleearffgidsliehlevaikns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxhC (C:)
    nadwltlnvggryftttrstlvnkepdsmlahmfkdkqdhrgaflidrspeyfepilnyl
    rhgqlivndginllgvleearffgidsliehlevaikns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bxhD (D:)
    snadwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyf
    epilnylrhgqlivndginllgvleearffgidsliehlevaikns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxhD (D:)
    adwltlnvggryftttrstlvnkepdsmlahmfkwgnkqdhrgaflidrspeyfepilny
    lrhgqlivndginllgvleearffgidsliehlevaikns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bxhE (E:)
    snadwltlnvggryftttrstlvnkepdsmlahmfkdkgvwgnkqdhrgaflidrspeyf
    epilnylrhgqlivndginllgvleearffgidsliehlevaikns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxhE (E:)
    dwltlnvggryftttrstlvnkepdsmlahmfkdkqdhrgaflidrspeyfepilnylrh
    gqlivndginllgvleearffgidsliehlevaikns