PDB entry 5bxd

View 5bxd on RCSB PDB site
Description: Crystal structure of pentameric KCTD1 BTB domain form 2
Class: protein binding
Keywords: protein binding
Deposited on 2015-06-08, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bxda_
  • Chain 'B':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxdb1, d5bxdb2
  • Chain 'C':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxdc1, d5bxdc2
  • Chain 'D':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxdd1, d5bxdd2
  • Chain 'E':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxde1, d5bxde2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bxdA (A:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxdA (A:)
    napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil
    nflrtskllipddfkdytllyeeakyfqlqpmllemerwkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bxdB (B:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxdB (B:)
    nanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfry
    ilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bxdC (C:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxdC (C:)
    nanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfry
    ilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bxdD (D:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bxdE (E:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxdE (E:)
    nanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfry
    ilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre