PDB entry 5bxb

View 5bxb on RCSB PDB site
Description: Crystal structure of pentameric KCTD1 BTB domain form 1
Class: protein binding
Keywords: protein binding
Deposited on 2015-06-08, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (2)
    Domains in SCOPe 2.07: d5bxba1, d5bxba2
  • Chain 'B':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (2)
    Domains in SCOPe 2.07: d5bxbb1, d5bxbb2
  • Chain 'C':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbc1, d5bxbc2
  • Chain 'D':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbd1, d5bxbd2
  • Chain 'E':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5bxbe1, d5bxbe2
  • Chain 'F':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbf1, d5bxbf2
  • Chain 'G':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbg1, d5bxbg2
  • Chain 'H':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbh1, d5bxbh2
  • Chain 'I':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5bxbi1, d5bxbi2
  • Chain 'J':
    Compound: BTB/POZ domain-containing protein KCTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD1, C18orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q719H9 (3-106)
      • expression tag (2)
    Domains in SCOPe 2.07: d5bxbj1, d5bxbj2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bxbA (A:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbA (A:)
    anapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryi
    lnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bxbB (B:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbB (B:)
    anapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryi
    lnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bxbC (C:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbC (C:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bxbD (D:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bxbE (E:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbE (E:)
    nanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfry
    ilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bxbF (F:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbF (F:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bxbG (G:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbG (G:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bxbH (H:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bxbI (I:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bxbJ (J:)
    snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
    yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bxbJ (J:)
    anapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryi
    lnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre