PDB entry 5bwf

View 5bwf on RCSB PDB site
Description: Crystal structure of the beta-glucosidase from Trichoderma harzianum
Class: hydrolase
Keywords: beta-glucosidase, GH1 family, HYDROLASE
Deposited on 2015-06-07, released 2016-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,4-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: Bgl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3FPG4 (20-472)
      • expression tag (13-19)
      • expression tag (473-483)
    Domains in SCOPe 2.06: d5bwfa1, d5bwfa2, d5bwfa3
  • Chain 'B':
    Compound: Beta-1,4-glucosidase
    Species: TRICHODERMA HARZIANUM [TaxId:5544]
    Gene: Bgl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3FPG4 (20-472)
      • expression tag (13-19)
      • expression tag (473-483)
    Domains in SCOPe 2.06: d5bwfb1, d5bwfb2, d5bwfb3
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bwfA (A:)
    mgsshhhhhhssglvprgshmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgk
    iadgtsgvtacdsynrtaediallkslgaksyrfsiswsriipkggrddpvnqlgidhya
    qfvddlleagitpfitlfhwdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnw
    itfneplcsaipgygsgtfapgrqsttepwivghnllvahgravkvyrdefkdlndgqig
    ivlngdftypwdssdpldreaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpe
    ekafvlgsndfygmnhytsnyirhrtspataddtvgnvdvlfynkegqcigpetesswlr
    pcpagfrdflvwiskrynypkiyvtengtslkgendlpkekileddfrvnyyneyiramf
    taatldgvnvkgyfawslmdnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfde
    liake
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bwfA (A:)
    lvprgshmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacds
    ynrtaediallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitp
    fitlfhwdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipg
    ygsgtfapgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwds
    sdpldreaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfyg
    mnhytsnyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwi
    skrynypkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgy
    fawslmdnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bwfB (B:)
    mgsshhhhhhssglvprgshmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgk
    iadgtsgvtacdsynrtaediallkslgaksyrfsiswsriipkggrddpvnqlgidhya
    qfvddlleagitpfitlfhwdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnw
    itfneplcsaipgygsgtfapgrqsttepwivghnllvahgravkvyrdefkdlndgqig
    ivlngdftypwdssdpldreaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpe
    ekafvlgsndfygmnhytsnyirhrtspataddtvgnvdvlfynkegqcigpetesswlr
    pcpagfrdflvwiskrynypkiyvtengtslkgendlpkekileddfrvnyyneyiramf
    taatldgvnvkgyfawslmdnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfde
    liake
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bwfB (B:)
    lvprgshmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacds
    ynrtaediallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitp
    fitlfhwdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipg
    ygsgtfapgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwds
    sdpldreaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfyg
    mnhytsnyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwi
    skrynypkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgy
    fawslmdnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak