PDB entry 5bw7

View 5bw7 on RCSB PDB site
Description: Crystal structure of nonfucosylated Fc Y296W mutant complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa
Class: immune system
Keywords: immune system, complex, fc fragment, igg, receptor, cd16, gamma
Deposited on 2015-06-06, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (71)
    Domains in SCOPe 2.06: d5bw7a1, d5bw7a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (71)
    Domains in SCOPe 2.06: d5bw7b1, d5bw7b2
  • Chain 'C':
    Compound: Low affinity immunoglobulin gamma Fc region receptor III-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FCGR3A, CD16A, FCG3, FCGR3, IGFR3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08637
      • engineered mutation (71)
      • engineered mutation (155)
      • engineered mutation (166)
    Domains in SCOPe 2.06: d5bw7c1, d5bw7c2
  • Heterogens: NAG, BMA, MAN, GAL, CL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bw7A (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bw7A (A:)
    ellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpr
    eeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlp
    psrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltv
    dksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bw7B (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bw7B (B:)
    papellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
    kpreeqwnstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvy
    tlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysk
    ltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bw7C (C:)
    edlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaat
    vddsgeyrcqtqlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvt
    ylqngkgrkyfhhnsdfyipkatlkdsgsyfcrglvgsknvssetvqititqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bw7C (C:)
    vflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtqlstls
    dpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdf
    yipkatlkdsgsyfcrglvgsknvssetvqititq