PDB entry 5bt3

View 5bt3 on RCSB PDB site
Description: Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
Class: transcription
Keywords: p300, transcription regulation, histone acetyltransferase, Structural Genomics, Structural Genomics Consortium, SGC, transcription
Deposited on 2015-06-02, released 2015-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300
    Species: Homo sapiens [TaxId:9606]
    Gene: EP300, P300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bt3a_
  • Heterogens: 2LO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5bt3A (A:)
smifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrk
ldtgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >5bt3A (A:)
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg