PDB entry 5brq

View 5brq on RCSB PDB site
Description: Crystal structure of Bacillus licheniformis trehalose-6-phosphate hydrolase (TreA)
Class: hydrolase
Keywords: trehalose-6-phosphate hydrolase, TIM barrel, GH13 family, HYDROLASE
Deposited on 2015-06-01, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5brqa1, d5brqa2
  • Chain 'B':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5brqb1, d5brqb2
  • Chain 'C':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5brqc1, d5brqc2
  • Chain 'D':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5brqd1, d5brqd2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brqA (A:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brqA (A:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5brqB (B:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brqB (B:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5brqC (C:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brqC (C:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5brqD (D:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brqD (D:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfrldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak