PDB entry 5brp

View 5brp on RCSB PDB site
Description: Crystal structure of Bacillus licheniformis trehalose-6-phosphate hydrolase (TreA), mutant R201Q, in complex with PNG
Class: hydrolase
Keywords: trehalose-6-phosphate, hydrolase, PNG, GH13 family, TIM barrel
Deposited on 2015-06-01, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MI2
      • engineered mutation (206)
    Domains in SCOPe 2.06: d5brpa1, d5brpa2
  • Chain 'B':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MI2
      • engineered mutation (206)
    Domains in SCOPe 2.06: d5brpb1, d5brpb2
  • Chain 'C':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MI2
      • engineered mutation (206)
    Domains in SCOPe 2.06: d5brpc1, d5brpc2
  • Chain 'D':
    Compound: Glycoside Hydrolase Family 13
    Species: Bacillus licheniformis ATCC 14580 = DSM 13 [TaxId:279010]
    Gene: treA, BL03069
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65MI2
      • engineered mutation (206)
    Domains in SCOPe 2.06: d5brpd1, d5brpd2
  • Heterogens: PNG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brpA (A:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brpA (A:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5brpB (B:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brpB (B:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5brpC (C:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brpC (C:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5brpD (D:)
    hhhhhhmetkenpwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwlt
    piyqspqndngydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwf
    keaasgkenlyrdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadl
    nweneavrkkvyemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvhe
    flnemnrevfskydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwa
    ladfdflklkkilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlata
    ihmlqgtpyiyqgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksr
    dnsrtpvqwngeenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefd
    iittgdyqlileddqelyaylrngadekllvinnfygketefqlpddidiegydakvlis
    ndtdlpesfkrftvkpyqsivyhlakpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brpD (D:)
    npwwkkavvyqiypksfkdttgngvgdirgiiekldyikelacdviwltpiyqspqndng
    ydisdyysiheeygtmadfeelleeahkrgikvimdlvvnhtstehrwfkeaasgkenly
    rdfyiwkdmkpngapptnweskfggsawefhaesgqyylhlydvtqadlnweneavrkkv
    yemmhfwfekgidgfqldvinviskdqrfpdddegdgrrfytdgprvheflnemnrevfs
    kydsmtvgemssttiadcirytnpesreldmvfnfhhlkadypngekwaladfdflklkk
    ilsewqtemnkgggwnalfwcnhdqprivsrygddgkyrkksakmlataihmlqgtpyiy
    qgeelgmtnpkfddislyrdveslnmyrilkeagkpeaeiieilkaksrdnsrtpvqwng
    eenagftagtpwipvpdnykeinaeealndpdsifyhykklnelrkefdiittgdyqlil
    eddqelyaylrngadekllvinnfygketefqlpddidiegydakvlisndtdlpesfkr
    ftvkpyqsivyhlak