PDB entry 5brl

View 5brl on RCSB PDB site
Description: Crystal Structure of L124D STARD4
Class: lipid binding protein
Keywords: lipid binding protein, alpha helix grip
Deposited on 2015-05-31, released 2015-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StAR-related lipid transfer protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Stard4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JV5 (0-209)
      • engineered mutation (111)
    Domains in SCOPe 2.06: d5brla_
  • Chain 'B':
    Compound: StAR-related lipid transfer protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Stard4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JV5 (0-209)
      • engineered mutation (111)
    Domains in SCOPe 2.06: d5brlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5brlA (A:)
    rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq
    gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref
    vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd
    lrgmipqsavdtamastlanfysdlrkglr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5brlB (B:)
    rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq
    gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref
    vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd
    lrgmipqsavdtamastlanfysdlrkglr