PDB entry 5bq7

View 5bq7 on RCSB PDB site
Description: Crystal structure of chikungunya virus-human Fab 5F-10 fragment
Class: immune system
Keywords: Human antibody Fab fragment, Immune System
Deposited on 2015-05-28, released 2015-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 5F-10-Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5BQ7 (0-End)
  • Chain 'B':
    Compound: Fab 5F-10-Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5BQ7
    Domains in SCOPe 2.07: d5bq7b1, d5bq7b2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bq7B (B:)
    qsvltqppsvsgapgqrvtisctgsssnigashdvhwyqqlpgtaptlliyvnsnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsnlsgsavfgggtkltvlgqplaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bq7B (B:)
    vltqppsvsgapgqrvtisctssnvhwyqqlpgtaptlliyvnsnrpsgvpdrfsgsksg
    tsaslaitglqaedeadyycqsygsavfgggtkltvlgqplaapsvtlfppsseelqank
    atlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeqwkshk
    syscqvthegstvektvapte