PDB entry 5bmi

View 5bmi on RCSB PDB site
Description: Nitroxide Spin Labels in Protein GB1: T44 Mutant, Crystal Form A
Class: immune system
Keywords: Bacterial Proteins, Electron Spin Resonance Spectroscopy, IMMUNE SYSTEM
Deposited on 2015-05-22, released 2016-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d5bmia_
  • Heterogens: MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmiA (A:)
    mqyklilngktlkgettteavdaataekvfkqyandngvdgewcyddatktftvte