PDB entry 5bmh

View 5bmh on RCSB PDB site
Description: Nitroxide Spin Labels in Protein GB1: T44 Mutant, Crystal Form B
Class: immune system
Keywords: Bacterial Proteins, Electron Spin Resonance Spectroscopy, IMMUNE SYSTEM
Deposited on 2015-05-22, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d5bmha_
  • Heterogens: MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmhA (A:)
    mqyklilngktlkgettteavdaataekvfkqyandngvdgewcyddatktftvte