PDB entry 5bmg

View 5bmg on RCSB PDB site
Description: Nitroxide Spin Labels in Protein GB1: E15 Mutant
Class: immune system
Keywords: Bacterial Proteins, Crystallization, Electron Spin Resonance Spectroscopy, IMMUNE SYSTEM
Deposited on 2015-05-22, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmga_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgb_
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgc_
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgd_
  • Chain 'E':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmge_
  • Chain 'F':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgf_
  • Chain 'G':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgg_
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (14)
    Domains in SCOPe 2.07: d5bmgh_
  • Heterogens: MTN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgA (A:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgB (B:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgC (C:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgD (D:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgE (E:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgF (F:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgG (G:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bmgH (H:)
    mqyklilngktlkgcttteavdaataekvfkqyandngvdgewtyddatktftvte