PDB entry 5bk8

View 5bk8 on RCSB PDB site
Description: Cancer-associated SHP2/T507K mutant
Class: hydrolase
Keywords: Phosphatase, SHP2, PTPN11, T507K, HYDROLASE
Deposited on 2019-06-01, released 2020-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (506)
    Domains in SCOPe 2.07: d5bk8a1, d5bk8a2, d5bk8a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bk8A (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqkeaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bk8A (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkea
    eklltekgkhgsflvresqshpgdfvlsvrtgdgkskvthvmircqelkydvgggerfds
    ltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskqgfweefetlqqqe
    ckllysrkegqrqenknknryknilpfdhtrvvlhdgdvsdyinaniimpefepkksyia
    tqgclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvk
    esaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesi
    mdagpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqkea
    qyrfiymavqhyietlqr