PDB entry 5bca

View 5bca on RCSB PDB site
Description: beta-amylase from bacillus cereus var. mycoides
Deposited on 1999-03-12, released 2000-03-15
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bcaA (A:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bcaB (B:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bcaC (C:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bcaD (D:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw