PDB entry 5b8b

View 5b8b on RCSB PDB site
Description: Crystal structure of reduced chimeric E.coli AhpC1-186-YFSKHN
Class: oxidoreductase
Keywords: Alkylhydroperoxide reductase, AhpC, Peroxiredoxins, chimeric, OXIDOREDUCTASE
Deposited on 2016-06-14, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8ba_
  • Chain 'B':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bb_
  • Chain 'C':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bc_
  • Chain 'D':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bd_
  • Chain 'E':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8be_
  • Chain 'F':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bf_
  • Chain 'G':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bg_
  • Chain 'H':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bh_
  • Chain 'I':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bi_
  • Chain 'J':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b8bj_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b8bA (A:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bA (A:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b8bB (B:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bB (B:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b8bC (C:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bC (C:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b8bD (D:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bD (D:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5b8bE (E:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bE (E:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5b8bF (F:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bF (F:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5b8bG (G:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bG (G:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5b8bH (H:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bH (H:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5b8bI (I:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bI (I:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5b8bJ (J:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8bJ (J:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevc