PDB entry 5b8a

View 5b8a on RCSB PDB site
Description: Crystal structure of oxidized chimeric EcAhpC1-186-YFSKHN
Class: oxidoreductase
Keywords: Alkylhydroperoxide reductase, AhpC, Peroxiredoxins, chimeric, OXIDOREDUCTASE
Deposited on 2016-06-14, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8aa_
  • Chain 'B':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ab_
  • Chain 'C':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ac_
  • Chain 'D':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ad_
  • Chain 'E':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ae_
  • Chain 'F':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8af_
  • Chain 'G':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ag_
  • Chain 'H':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ah_
  • Chain 'I':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ai_
  • Chain 'J':
    Compound: Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX2, NKEFB, TDPX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8aj_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b8aA (A:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aA (A:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b8aB (B:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aB (B:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b8aC (C:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aC (C:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b8aD (D:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aD (D:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5b8aE (E:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aE (E:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5b8aF (F:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aF (F:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgev
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5b8aG (G:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aG (G:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5b8aH (H:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aH (H:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5b8aI (I:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aI (I:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5b8aJ (J:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakwkegeatlaps
    ldlvgkyfskhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8aJ (J:)
    mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
    lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
    atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpgevcpakw