PDB entry 5b83

View 5b83 on RCSB PDB site
Description: Crystal structure of Optineurin UBAN in complex with linear ubiquitin
Class: signaling protein
Keywords: ubiquitin, coiled-coil, cellular, signaling, nfkb pathway, signaling protein
Deposited on 2016-06-12, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetra ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b83a1, d5b83a2, d5b83a3, d5b83a4
  • Chain 'B':
    Compound: Optineurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OPTN, FIP2, GLC1E, HIP7, HYPL, NRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Optineurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OPTN, FIP2, GLC1E, HIP7, HYPL, NRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: tetra ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b83d1, d5b83d2, d5b83d3, d5b83d4
  • Chain 'E':
    Compound: Optineurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OPTN, FIP2, GLC1E, HIP7, HYPL, NRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Optineurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OPTN, FIP2, GLC1E, HIP7, HYPL, NRP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b83A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgkt
    itlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlr
    lrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b83A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgkt
    itlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlr
    lr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b83D (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgkt
    itlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlr
    lrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b83D (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevepsdtienvka
    kiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgkt
    itlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.