PDB entry 5b7x

View 5b7x on RCSB PDB site
Description: NMR Solution structure of an EF-hand Calcium binding protein (EhCaBP6) from Entamoeba Histolytica
Class: metal binding protein
Keywords: EF-hand, GTPase, Nuclear Protein, METAL BINDING PROTEIN
Deposited on 2016-06-10, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin, putative
    Species: Entamoeba histolytica HM-3:IMSS [TaxId:885315]
    Gene: KM1_072120
    Database cross-references and differences (RAF-indexed):
    • Uniprot M7WXJ8 (0-149)
      • expression tag (150-155)
    Domains in SCOPe 2.06: d5b7xa1, d5b7xa2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b7xA (A:)
    msmeieapnantqkirdcfnfydrdydgkidvkqlgtlirslgcaptedevnsyikefai
    egetfqieqfelimereqskpdtreiklrkafevfdqdkdgkikasdlahnlttvgdkmt
    keevekvfsilgitmesdidlatflklvalhhhhhh