PDB entry 5b7v

View 5b7v on RCSB PDB site
Description: Human FGFR1 kinase in complex with CH5183284
Class: transferase/transferase inhibitor
Keywords: protein kinase, ATP-binding, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-06-09, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b7va_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b7vb_
  • Heterogens: LWJ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b7vA (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b7vA (A:)
    elpedprwelprdrlvlgkplgeqvvlaeaigldkdkpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpppeeqlssk
    dlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglarhidyykkttngr
    lpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdk
    psnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b7vB (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b7vB (B:)
    eyelpedprwelprdrlvlgkplgegqvvlaeaigldkpnrvtkvavkmlksdatekdls
    dlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeeqlsskd
    lvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardyykkttgrlpvk
    wmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnc
    tnelymmmrdcwhavpsqrptfkqlvedldrivalts