PDB entry 5b7p

View 5b7p on RCSB PDB site
Description: Structures and functional analysis of periplasmic 5-methylthioadenosine/S-adenosylhomocysteine nucleosidase from Aeromonas hydrophila
Class: hydrolase
Keywords: Aeromonas hydrophila, MtaN-1, MtaN-2, SAH, MTA, 5-DAO, HYDROLASE
Deposited on 2016-06-08, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Aeromonas hydrophila [TaxId:380703]
    Gene: mtnN-1, AHA_0953
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b7pa_
  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Aeromonas hydrophila [TaxId:380703]
    Gene: mtnN-1, AHA_0953
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b7pb_
  • Heterogens: MTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b7pA (A:)
    asapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaa
    ttlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwh
    nfevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvari
    nwlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvid
    yakalingf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b7pB (B:)
    asapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaa
    ttlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwh
    nfevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvari
    nwlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvid
    yakalingf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b7pB (B:)
    sapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaat
    tlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwhn
    fevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvarin
    wlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvidy
    akalingf