PDB entry 5b2d

View 5b2d on RCSB PDB site
Description: Crystal structure of Mumps virus hemagglutinin-neuraminidase bound to 3-sialyllactose
Class: viral protein
Keywords: glycoprotein, viral protein, beta-propeller, receptor binding, sugar
Deposited on 2016-01-14, released 2016-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HN protein
    Species: Mumps virus [TaxId:11161]
    Gene: HN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b2da_
  • Chain 'B':
    Compound: HN protein
    Species: Mumps virus [TaxId:11161]
    Gene: HN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b2db_
  • Heterogens: NAG, SLT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b2dA (A:)
    etggnqnqllstlatirtgkkqvsncstniplvndlrfinginkfiiedyathdfsighp
    lnmpsfiptatspngctripsfslgkthwcythnvinanckdhtssnqyismgilvqtas
    gypmfktlkiqylsdglnrkscsiatvpdgcamycyvstqletddyagsspptqkltllf
    yndtvtertisptglegnwatlvpgvgsgiyfenklifpayggvlpnstlgvksareffr
    pvnpynpcsgpqqdldqralrsyfpsyfsnrrvqsaflvcawnqilvtncelvvpsnnqt
    lmgaegrvllinnrllyyqrstswwpyellyeisftftnsgqssvnmswipiysftrpgs
    gncsgenvcptacvsgvyldpwpltpyshqsginrnfyftgallnssttrvnptlyvsal
    nnlkvlapygnqglfasyttttcfqdtgdasvycvyimelasnivgefqilpvltrltit
    gtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b2dA (A:)
    plvndlrfinginkfiiedyathdfsighplnmpsfiptatspngctripsfslgkthwc
    ythnvinanckdhtssnqyismgilvqtasgypmfktlkiqylsdglnrkscsiatvpdg
    camycyvstqletddyagsspptqkltllfyndtvtertisptglegnwatlvpgvgsgi
    yfenklifpayggvlpnstlgvksareffrpvnpynpcsgpqqdldqralrsyfpsyfsn
    rrvqsaflvcawnqilvtncelvvpsnnqtlmgaegrvllinnrllyyqrstswwpyell
    yeisftftnsgqssvnmswipiysftrpgsgncsgenvcptacvsgvyldpwpltpyshq
    sginrnfyftgallnssttrvnptlyvsalnnlkvlapygnqglfasyttttcfqdtgda
    svycvyimelasnivgefqilpvltrltit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b2dB (B:)
    etggnqnqllstlatirtgkkqvsncstniplvndlrfinginkfiiedyathdfsighp
    lnmpsfiptatspngctripsfslgkthwcythnvinanckdhtssnqyismgilvqtas
    gypmfktlkiqylsdglnrkscsiatvpdgcamycyvstqletddyagsspptqkltllf
    yndtvtertisptglegnwatlvpgvgsgiyfenklifpayggvlpnstlgvksareffr
    pvnpynpcsgpqqdldqralrsyfpsyfsnrrvqsaflvcawnqilvtncelvvpsnnqt
    lmgaegrvllinnrllyyqrstswwpyellyeisftftnsgqssvnmswipiysftrpgs
    gncsgenvcptacvsgvyldpwpltpyshqsginrnfyftgallnssttrvnptlyvsal
    nnlkvlapygnqglfasyttttcfqdtgdasvycvyimelasnivgefqilpvltrltit
    gtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b2dB (B:)
    plvndlrfinginkfiiedyathdfsighplnmpsfiptatspngctripsfslgkthwc
    ythnvinanckdhtssnqyismgilvqtasgypmfktlkiqylsdglnrkscsiatvpdg
    camycyvstqletddyagsspptqkltllfyndtvtertisptglegnwatlvpgvgsgi
    yfenklifpayggvlpnstlgvksareffrpvnpynpcsgpqqdldqralrsyfpsyfsn
    rrvqsaflvcawnqilvtncelvvpsnnqtlmgaegrvllinnrllyyqrstswwpyell
    yeisftftnsgqssvnmswipiysftrpgsgncsgenvcptacvsgvyldpwpltpyshq
    sginrnfyftgallnssttrvnptlyvsalnnlkvlapygnqglfasyttttcfqdtgda
    svycvyimelasnivgefqilpvltrltit