PDB entry 5b28

View 5b28 on RCSB PDB site
Description: The 0.90A structure of human FABP3 F16V mutant complexed with palmitic acid
Class: lipid binding protein
Keywords: LIPID BINDING PROTEIN, complex, palmitic acid
Deposited on 2016-01-12, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: N/A
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (0-132)
      • engineered mutation (16)
    Domains in SCOPe 2.06: d5b28a_
  • Heterogens: PLM, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b28A (A:)
    mvdaflgtwklvdsknvddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyekea