PDB entry 5b21

View 5b21 on RCSB PDB site
Description: Dimer structure of murine Nectin-1 D1
Class: cell adhesion
Keywords: Cell Adhesion Molecules, CAM, Immunoglobulin-like domains, CELL ADHESION
Deposited on 2015-12-28, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: murine Nectin-1 D1
    Species: Mus musculus [TaxId:10090]
    Gene: PVRL1, HVEC, PRR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b21a_
  • Chain 'B':
    Compound: murine Nectin-1 D1
    Species: Mus musculus [TaxId:10090]
    Gene: PVRL1, HVEC, PRR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b21b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b21A (A:)
    qvvqvndsmygfigtdvvlhcsfanplpsvkitqvtwqkasngskqnmaiynptmgvsvl
    ppyekrveflrpsfidgtirlsgleledegmyicefatfptgnresqlnltvma
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b21B (B:)
    qvvqvndsmygfigtdvvlhcsfanplpsvkitqvtwqkasngskqnmaiynptmgvsvl
    ppyekrveflrpsfidgtirlsgleledegmyicefatfptgnresqlnltvma