PDB entry 5b1z

View 5b1z on RCSB PDB site
Description: Crystal structure of Bcl-xL in complex with HBx-BH3 motif
Class: apoptosis
Keywords: HBx, Bcl-xL, HBV replication, APOPTOSIS
Deposited on 2015-12-22, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b1za_
  • Chain 'B':
    Compound: Bcl-2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b1zb_
  • Chain 'C':
    Compound: Peptide from Protein X
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peptide from Protein X
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b1zA (A:)
    msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaaaesrkgqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1zA (A:)
    msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b1zB (B:)
    msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaaaesrkgqer
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1zB (B:)
    msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
    gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
    hlepwiqenggwdtfvelygnnaa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.