PDB entry 5b1w

View 5b1w on RCSB PDB site
Description: Crystal structure of human dendritic cell inhibitory receptor (DCIR) C-type lectin domain in ligand-free form
Class: carbohydrate binding protein
Keywords: C-type lectin domain, innate immunity, carbohydrate recognition, CARBOHYDRATE BINDING PROTEIN
Deposited on 2015-12-21, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4A, CLECSF6, DCIR, LLIR, HDCGC13P
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMR7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5b1wa1, d5b1wa2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4A, CLECSF6, DCIR, LLIR, HDCGC13P
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMR7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5b1wb1, d5b1wb2
  • Chain 'C':
    Compound: C-type lectin domain family 4 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4A, CLECSF6, DCIR, LLIR, HDCGC13P
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMR7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5b1wc1, d5b1wc2
  • Chain 'D':
    Compound: C-type lectin domain family 4 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC4A, CLECSF6, DCIR, LLIR, HDCGC13P
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMR7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5b1wd1, d5b1wd2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b1wA (A:)
    gscpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesay
    fvglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvncl
    gpqrsvcemmkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1wA (A:)
    scpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayf
    vglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclg
    pqrsvcemmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b1wB (B:)
    gscpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesay
    fvglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvncl
    gpqrsvcemmkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1wB (B:)
    scpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayf
    vglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclg
    pqrsvcemmk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b1wC (C:)
    gscpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesay
    fvglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvncl
    gpqrsvcemmkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1wC (C:)
    scpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayf
    vglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclg
    pqrsvcem
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b1wD (D:)
    gscpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesay
    fvglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvncl
    gpqrsvcemmkihl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1wD (D:)
    scpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayf
    vglsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclg
    pqrsvcem