PDB entry 5b1c

View 5b1c on RCSB PDB site
Description: Crystal structure of DEN4 ED3 mutant with L387I
Class: immune system
Keywords: Hydrophobic core residue, Side-chain rotamers, Point mutation, Immune system
Deposited on 2015-12-02, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope protein E
    Species: Dengue virus 4 Dominica/814669/1981 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866 (2-End)
      • expression tag (1)
      • engineered mutation (95)
    Domains in SCOPe 2.06: d5b1ca1, d5b1ca2
  • Chain 'B':
    Compound: Envelope protein E
    Species: Dengue virus 4 Dominica/814669/1981 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866
      • engineered mutation (95)
    Domains in SCOPe 2.06: d5b1cb_
  • Chain 'C':
    Compound: Envelope protein E
    Species: Dengue virus 4 Dominica/814669/1981 [TaxId:408871]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09866
      • engineered mutation (95)
    Domains in SCOPe 2.06: d5b1cc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b1cA (A:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgnsaltihwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1cA (A:)
    sgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tplaentnsvtnieleppfgdsyivigvgnsaltihwfrkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b1cB (B:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgnsaltihwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1cB (B:)
    ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpla
    entnsvtnieleppfgdsyivigvgnsaltihwfrkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b1cC (C:)
    gsgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriis
    stplaentnsvtnieleppfgdsyivigvgnsaltihwfrkgssigk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1cC (C:)
    sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
    aentnsvtnieleppfgdsyivigvgnsaltihwfrkg