PDB entry 5b13

View 5b13 on RCSB PDB site
Description: Crystal structure of phycoerythrin
Class: photosynthesis
Keywords: Phycobiliprotein, PHOTOSYNTHESIS
Deposited on 2015-11-18, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13a_
  • Chain 'B':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13b_
  • Chain 'C':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13c_
  • Chain 'D':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13d_
  • Chain 'E':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13e_
  • Chain 'F':
    Compound: Phycoerythrin alpha subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13f_
  • Chain 'G':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13g_
  • Chain 'H':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13h_
  • Chain 'I':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13i_
  • Chain 'J':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13j_
  • Chain 'K':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13k_
  • Chain 'L':
    Compound: phycoerythrin beta subunit
    Species: Palmaria palmata [TaxId:2822]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b13l_
  • Heterogens: CYC, PUB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13A (A:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13B (B:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13C (C:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13D (D:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13E (E:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13F (F:)
    mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf
    akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl
    nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13G (G:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13H (H:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13I (I:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13J (J:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13K (K:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b13L (L:)
    mldafsrvvvnsdakaayvggsdlqalkkfitdgnkrldsvsfvvsnascivsdavsgmi
    cenpgliapggncytnrrmaaclrdgeiilryasyallagdpsvledrclnglketyial
    gvptnssvravsimkasatafvsgtasdrkmacpdgdcsalaselgsycdrvaaais