PDB entry 5b08

View 5b08 on RCSB PDB site
Description: Polyketide cyclase OAC from Cannabis sativa
Class: lyase
Keywords: Cannabis sativa, plant polyketide cyclase, LYASE
Deposited on 2015-10-28, released 2016-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Olivetolic acid cyclase
    Species: Cannabis sativa [TaxId:3483]
    Gene: OAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5b08a_
  • Chain 'B':
    Compound: Olivetolic acid cyclase
    Species: Cannabis sativa [TaxId:3483]
    Gene: OAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6WU39 (3-103)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d5b08b1, d5b08b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5b08A (A:)
gpgmavkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegyth
ivevtfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

    Sequence, based on observed residues (ATOM records): (download) 
    >5b08A (A:)
avkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b08B (B:)
gpgmavkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegyth
ivevtfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk