PDB entry 5azh

View 5azh on RCSB PDB site
Description: Crystal structure of LGG-2 fused with an EEEWEEL peptide
Class: protein binding
Keywords: autophagy, ubiquitin-like, PROTEIN BINDING
Deposited on 2015-10-05, released 2015-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-30, with a file datestamp of 2015-12-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EEEWEEL peptide,Protein lgg-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lgg-2
    Database cross-references and differences (RAF-indexed):
    • PDB 5AZH (Start-6)
      • linker (7)
    • Uniprot Q23536 (8-127)
    Domains in SCOPe 2.06: d5azha_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5azhA (A:)
    eeeweelgsgivpsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckf
    lvpehitvaelmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymv
    ytsqpafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azhA (A:)
    eeweelgsgivpsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckfl
    vpehitvaelmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvy
    tsqpafg