PDB entry 5az2

View 5az2 on RCSB PDB site
Description: Crystal structure of the Fab fragment of 9E5, a murine monoclonal antibody specific for human epiregulin
Class: immune system
Keywords: Antibody, Immunoglobulin, Monoclonal antibody, Epidermal growth factor, IMMUNE SYSTEM
Deposited on 2015-09-16, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: anti-human epiregulin antibody 9E5 Fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 5AZ2 (0-221)
• Chain 'L':
  Compound: anti-human epiregulin antibody 9E5 Fab light chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 5AZ2 (0-212)
  Domains in SCOPe 2.06: d5az2l1, d5az2l2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5az2L (L:)
  diqmtqspsslsaslggkvtitckasqdinkyiawyqhkpgkgprllihytstlhpgips
  rfsgsgsgrdysfsisnlepediatyyclqydnlrtfgggtkleikradaaptvsifpps
  seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
  tkdeyerhnsytceathktstspivksfnrnec