PDB entry 5ays

View 5ays on RCSB PDB site
Description: Crystal structure of SAUGI/HSV UDG complex
Class: hydrolase inhibitor
Keywords: DNA mimic protein, DNA mimicking, uracil-DNA glycosylase inhibitor, uracil-DNA glycosylase, Herpes simplex virus, HYDROLASE INHIBITOR
Deposited on 2015-09-02, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Human herpesvirus 1 (strain 17) [TaxId:10299]
    Gene: UL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10186 (Start-243)
      • expression tag (244-245)
    Domains in SCOPe 2.07: d5aysa1, d5aysa2
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Human herpesvirus 1 (strain 17) [TaxId:10299]
    Gene: UL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10186 (Start-243)
      • expression tag (244-245)
    Domains in SCOPe 2.07: d5aysb1, d5aysb2
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aysA (A:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispi
    dwsvleellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aysA (A:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsvle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aysB (B:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispi
    dwsvleellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aysB (B:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsvle
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.