PDB entry 5ayg

View 5ayg on RCSB PDB site
Description: Crystal Structure of the Human ROR gamma Ligand Binding Domain With 3g
Class: DNA binding protein/inhibitor
Keywords: Inhibitor, Complex, Nuclear Receptor, DNA BINDING PROTEIN-INHIBITOR complex
Deposited on 2015-08-20, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ayga_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aygb_
  • Heterogens: 4LQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aygA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aygA (A:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aygB (B:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aygB (B:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhver