PDB entry 5ay7

View 5ay7 on RCSB PDB site
Description: A psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
Class: hydrolase
Keywords: xylanase, GH10, TIM-barrel fold, HYDROLASE
Deposited on 2015-08-10, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Aegilops speltoides subsp. speltoides [TaxId:58531]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AY7
    Domains in SCOPe 2.06: d5ay7a_
  • Chain 'B':
    Compound: xylanase
    Species: Aegilops speltoides subsp. speltoides [TaxId:58531]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AY7
    Domains in SCOPe 2.06: d5ay7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ay7A (A:)
    mahhhhhhvddddkmaqglkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenam
    kpqptepkkgefnwedadkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeef
    yanmkhhiqaivnrykdvvycwdvvneavadspvypgrpelrnspmyqiageefiykafe
    yaheadpdallfyndyndaepaksqriynlvkrmkdagvpidgigmqahynvygptmkev
    ddaiklystvvdhihlteldirinedmggglrfnqgqatvsdwertlqqdqyvqlfkvlr
    khkdvidcvtfwnvsdkdswlgvrnypllfdenykpkqaynavknfdpkmdnavi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ay7A (A:)
    glkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnweda
    dkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnrykd
    vvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndyn
    daepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihlt
    eldirinvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdkdswlgvrnypllfde
    nykpkqaynavknfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ay7B (B:)
    mahhhhhhvddddkmaqglkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenam
    kpqptepkkgefnwedadkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeef
    yanmkhhiqaivnrykdvvycwdvvneavadspvypgrpelrnspmyqiageefiykafe
    yaheadpdallfyndyndaepaksqriynlvkrmkdagvpidgigmqahynvygptmkev
    ddaiklystvvdhihlteldirinedmggglrfnqgqatvsdwertlqqdqyvqlfkvlr
    khkdvidcvtfwnvsdkdswlgvrnypllfdenykpkqaynavknfdpkmdnavi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ay7B (B:)
    aqglkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnwe
    dadkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnry
    kdvvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfynd
    yndaepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhih
    lteldirinedmggglrfvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdkdswl
    gvrnypllfdenykpkqaynavknfd