PDB entry 5awf

View 5awf on RCSB PDB site
Description: Crystal structure of SufB-SufC-SufD complex from Escherichia coli
Class: transport protein/protein binding
Keywords: Iron-Sulfur Clusters, Iron-Sulfur Proteins, ABC proteins, ABC ATPase, TRANSPORT PROTEIN-PROTEIN BINDING complex
Deposited on 2015-07-03, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FeS cluster assembly protein SufB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufB, ynhE, b1683, JW5273
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: FeS cluster assembly protein SufD
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufD, ynhC, b1681, JW1671
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awfb_
  • Chain 'C':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufC, ynhD, b1682, JW1672
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awfc_
  • Chain 'D':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufC, ynhD, b1682, JW1672
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awfd_
  • Chain 'E':
    Compound: FeS cluster assembly protein SufB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufB, ynhE, b1683, JW5273
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: FeS cluster assembly protein SufD
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufD, ynhC, b1681, JW1671
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awff_
  • Chain 'G':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufC, ynhD, b1682, JW1672
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awfg_
  • Chain 'H':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: sufC, ynhD, b1682, JW1672
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5awfh_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5awfB (B:)
    maglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglins
    qfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpda
    iqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaeg
    aeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedat
    afshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrql
    hktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcsh
    gatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpg
    gar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfB (B:)
    snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
    eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
    hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
    hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
    lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
    kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
    ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5awfC (C:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfC (C:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5awfD (D:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfD (D:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5awfF (F:)
    maglpnssnalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglins
    qfvsiageispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpda
    iqaevflhlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaeg
    aeatviehfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedat
    afshsfllggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrql
    hktivsdkgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcsh
    gatvgriddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpg
    gar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfF (F:)
    snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
    eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
    hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
    hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
    lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
    kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
    ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5awfG (G:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfG (G:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5awfH (H:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awfH (H:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkql