PDB entry 5auk

View 5auk on RCSB PDB site
Description: Crystal structure of the Ga-substituted Ferredoxin
Class: electron transport
Keywords: Analogue, electron transfer protein
Deposited on 2015-04-24, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: petF, fed
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5auka_
  • Heterogens: GAK, SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aukA (A:)
    asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
    qsfldddqieagyvltcvayptsdctiethkeedly