PDB entry 5apk

View 5apk on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: transcription
Keywords: transcription, rorg ligand, rorg agonist, structure-based design
Deposited on 2015-09-16, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (22-End)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d5apka1, d5apka2
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5apkb_
  • Chain 'D':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 76E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5apkA (A:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5apkA (A:)
    enlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemw
    ercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvf
    fegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekr
    kveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5apkB (B:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5apkB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    

  • Chain 'D':
    No sequence available.