PDB entry 5aph

View 5aph on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: transcription
Keywords: transcription, rorg ligand, rorg agonist, structure-based design
Deposited on 2015-09-16, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (21-263)
      • expression tag (14-20)
      • expression tag (264-265)
    Domains in SCOPe 2.07: d5apha1, d5apha2, d5apha3
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VYI, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aphA (A:)
    hnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsre
    evtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlv
    rmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytal
    vlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverl
    qifqhlhpivvqaafpplykelfsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aphA (A:)
    enlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemw
    ercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvf
    fegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekr
    kveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaa
    fpplykelfsgg
    

  • Chain 'C':
    No sequence available.