PDB entry 5aoo

View 5aoo on RCSB PDB site
Description: X-ray structure of a human Kobuvirus: Aichi virus A (AiV)
Class: virus
Keywords: virus, aichi virus, kobuvirus, picornavirus, acute gastroenterisis, icosahedral capsid, full virus particle
Deposited on 2015-09-11, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp0
    Species: AICHIVIRUS A [TaxId:72149]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vp1
    Species: AICHIVIRUS A [TaxId:72149]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: AICHIVIRUS A [TaxId:72149]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aooc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5aooC (C:)
    hwktravpgagtfgsavagqelplcgvrayyppnayipaqvrdwlefahrpglmatvpwt
    madepaerlgifpvspsaiagtgapisyvislfsqwrgelaahllftgsaqhygrlvvcy
    tpaapqppstmqeamrgtytvwdvnaastleftipfisnsywktvdvnnpdallsttgyv
    siwvqnplvgphtapasalvqafisagesfnvrlmqnpaltsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aooC (C:)
    hwktravpgagtfgsavagqelplcgvrayyppnayipaqvrdwlefahrpglmatvpwt
    madepaerlgifpvspsaiagtgapisyvislfsqwrgelaahllftgsaqhygrlvvcy
    tpaapqppstmqeamrgtytvwdvnaastleftipfisnsywktvdvnnpdallsttgyv
    siwvqnplvgphtapasalvqafisagesfnvrlmqnpal