PDB entry 5aog

View 5aog on RCSB PDB site
Description: Structure of Sorghum peroxidase
Class: oxidoreductase
Keywords: oxidoreductase, heme peroxidase, glycoslylation, sorghum, plant peroxidase
Deposited on 2015-09-10, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic peroxidase spc4
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84516 (0-306)
      • conflict (125)
    Domains in SCOPe 2.05: d5aoga_
  • Heterogens: HEM, CA, NA, GOL, IAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aogA (A:)
    qpplapglsfdfykrscpkaesivrsfvqdavrrdvglaagllrlhfhdcfvqgcdasvl
    ldgsatgpgeqqappnltlrptafkaindihdrlhkecggtvvscsdvlalaardsvvvs
    ggpsyrvplgrrdsasfatqqdvlsglppptaavpallavlskinldatdlvalsgghti
    glghctsfedrlfprpdptlnatfagqlrrtcpakgtdrrtpldvrtpnafdnkyyvnlv
    nreglftsdqdlfsnartralvdkfarsqrdffdqfafsvvkmgqikvltgtqgqirtnc
    sarnaag