PDB entry 5anm

View 5anm on RCSB PDB site
Description: Crystal structure of IgE Fc in complex with a neutralizing antibody
Class: immune system
Keywords: immune system, therapeutic antibody, igg, ige, asthma
Deposited on 2015-09-07, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM
    Domains in SCOPe 2.07: d5anma1, d5anma2
  • Chain 'B':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM (0-End)
  • Chain 'C':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM
    Domains in SCOPe 2.07: d5anmc1, d5anmc2
  • Chain 'D':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM (0-End)
  • Chain 'E':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5anme1, d5anme2
  • Chain 'F':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5anmf1, d5anmf2
  • Chain 'G':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5anmg1, d5anmg2
  • Chain 'H':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM (0-End)
  • Chain 'L':
    Compound: immunoglobulin g
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ANM
    Domains in SCOPe 2.07: d5anml1, d5anml2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5anmA (A:)
    qsvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmA (A:)
    svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvp
    drfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5anmC (C:)
    qsvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmC (C:)
    svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvp
    drfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5anmE (E:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgkdykddddkaahhhhhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmE (E:)
    vsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrng
    tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpg
    srdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgffvfsrlevtraewe
    qkdeficravheaaspsqtvqravsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5anmF (F:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgkdykddddkaahhhhhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmF (F:)
    gvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrn
    gtltvtstlpvgtrdwiegetyqcrvthppralmrsttktsgpraapevyafatppgsrd
    krtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweq
    kdeficravheaaspsqtvqravsvnpg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5anmG (G:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgkdykddddkaahhhhhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmG (G:)
    gvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrkeekqrn
    gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewp
    gsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtra
    eweqkdeficravheaaspsqtvqravsvnp
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5anmL (L:)
    qsvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anmL (L:)
    vltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvpd
    rfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvpkaapsvtlfpp
    satlvclisdavtvawkadsspvkagvetttpskqaassylsltpeshrsyscqvthegs
    tvektvapt