PDB entry 5am7

View 5am7 on RCSB PDB site
Description: FGFR1 mutant with an inhibitor
Class: transferase
Keywords: transferase, fgfr, cancer, dovitinib, tki258, gatekeeper, gate keeper
Deposited on 2015-03-10, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (2-End)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5am7a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (2-End)
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5am7b_
  • Heterogens: 38O, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5am7A (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyvimeyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5am7A (A:)
    agvseyelpedprwelprdrlvlgkplgegqvvlaeaigldkdkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyvimeyaskgnlreylqarrppg
    peeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihh
    idyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelf
    kllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5am7B (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyvimeyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5am7B (B:)
    agvseyelpedprwelprdrlvlgkplgegqvvlaeaigldkdkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyvimeyaskgnlreylqarrppg
    peeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardyyk
    kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
    ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts