PDB entry 5ak2

View 5ak2 on RCSB PDB site
Description: Oxyphenylpropenoic acids as Oral Selective Estrogen Receptor Down- Regulators.
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-02-27, released 2015-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (20-End)
      • expression tag (16-19)
      • engineered mutation (94)
      • engineered mutation (130)
      • engineered mutation (249)
    Domains in SCOPe 2.06: d5ak2a1, d5ak2a2
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (94)
      • engineered mutation (130)
    Domains in SCOPe 2.06: d5ak2b_
  • Heterogens: 85Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ak2A (A:)
    mhhhhhhgggenlyfqgshmalsltadqmvsalldaeppilyseydptrpfseasmmgll
    tnladrelvhminwakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfap
    nllldrnqgksvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstl
    ksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehly
    smksknvvpsydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ak2A (A:)
    gshmalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvytsleekdhihrvldkitdtlihlmakagltlqq
    qhqrlaqlllilshirhmsnkgmehlysmvpsydlllemldahrlhap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ak2B (B:)
    mhhhhhhgggenlyfqgshmalsltadqmvsalldaeppilyseydptrpfseasmmgll
    tnladrelvhminwakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfap
    nllldrnqgksvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstl
    ksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehly
    smksknvvpsydlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ak2B (B:)
    lsltadqmvsalldaeppilysepfseasmmglltnladrelvhminwakrvpgfvdltl
    hdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllats
    srfrmmnlqgeefvclksiillnsgvykdhihrvldkitdtlihlmakagltlqqqhqrl
    aqlllilshirhmsnkgmehlysmllemld