PDB entry 5ahs

View 5ahs on RCSB PDB site
Description: 3-Sulfinopropionyl-Coenzyme A (3SP-CoA) desulfinase from Advenella mimgardefordensis DPN7T: holo crystal structure with the substrate analog succinyl-CoA
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2015-02-06, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahsa1, d5ahsa2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahsb1, d5ahsb2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahsc1, d5ahsc2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahsd1, d5ahsd2
  • Chain 'E':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahse1, d5ahse2
  • Chain 'F':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ahsf1, d5ahsf2
  • Heterogens: FAD, COA, SIN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ahsA (A:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsA (A:)
    yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
    glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
    cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
    fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalms
    aynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarl
    mlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarm
    ftiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ahsB (B:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsB (B:)
    yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
    glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
    cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
    fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalms
    aynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarl
    mlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarm
    ftiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ahsC (C:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsC (C:)
    yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
    glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
    cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
    fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalms
    aynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarl
    mlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarm
    ftiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ahsD (D:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsD (D:)
    eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
    lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
    isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
    itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalmsa
    ynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarlm
    lrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarmf
    tiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ahsE (E:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsE (E:)
    yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
    glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
    cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
    fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalms
    aynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarl
    mlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarm
    ftiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ahsF (F:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ahsF (F:)
    yeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggr
    glstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpai
    cisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgiga
    fitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalms
    aynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarl
    mlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarm
    ftiaggtaqilrtqvaskildmklpqtrdgy