PDB entry 5ah0

View 5ah0 on RCSB PDB site
Description: structure of lipase 1 from pelosinus fermentans
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-02-04, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: PELOSINUS FERMENTANS DSM 17108 [TaxId:1122947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I8S946 (0-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d5ah0a1, d5ah0a2
  • Chain 'B':
    Compound: Lipase
    Species: PELOSINUS FERMENTANS DSM 17108 [TaxId:1122947]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I8S946 (0-386)
      • expression tag (0)
    Domains in SCOPe 2.06: d5ah0b1, d5ah0b2
  • Heterogens: ZN, PEG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ah0A (A:)
    mnsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdrace
    lyayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtv
    rtlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfak
    nlvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdls
    tdgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrn
    eqgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmda
    cgigtnaltlswykglaeklsqltisn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ah0A (A:)
    mnsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdrace
    lyayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtv
    rtlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfak
    nlvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdls
    tdgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrn
    eqgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmda
    cgigtnaltlswykglaeklsqlti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ah0B (B:)
    mnsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdrace
    lyayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtv
    rtlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfak
    nlvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdls
    tdgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrn
    eqgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmda
    cgigtnaltlswykglaeklsqltisn