PDB entry 5ag2

View 5ag2 on RCSB PDB site
Description: SOD-3 azide complex
Class: oxidoreductase
Keywords: oxidoreductase, manganese
Deposited on 2015-01-27, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5ag2a1, d5ag2a2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn] 2, mitochondrial
    Species: CAENORHABDITIS ELEGANS [TaxId:6239]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41977 (1-194)
      • expression tag (0)
    Domains in SCOPe 2.05: d5ag2c1, d5ag2c2
  • Heterogens: MN, AZI, ACT, MLI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ag2A (A:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ag2A (A:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ag2C (C:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq