PDB entry 5afx

View 5afx on RCSB PDB site
Description: T. Brucei Farnesyl Diphosphate Synthase Complexed with Bisphosphonate BPH-1238
Class: transferase
Keywords: transferase
Deposited on 2015-01-27, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5afxa_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5afxb_
  • Heterogens: MG, PVZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5afxA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
    hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
    dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
    eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
    nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
    ktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5afxA (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5afxB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
    hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
    dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
    eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
    nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
    ktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5afxB (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llsdgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtvqcai
    ndglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkldpdvs
    qptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelamlmgey
    fqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgdsekv
    atvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrqk