PDB entry 5af7

View 5af7 on RCSB PDB site
Description: 3-Sulfinopropionyl-coenzyme A (3SP-CoA) desulfinase from Advenella mimigardefordensis DPN7T: crystal structure and function of a desulfinase with an acyl-CoA dehydrogenase fold. Native crystal structure
Class: hydrolase
Keywords: hydrolase, desulfinase, acyl-coa dehydrogenase, 3-sulfinopropionyl-coenzyme a, flavin adenine dinucleotide
Deposited on 2015-01-20, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5af7a1, d5af7a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: ADVENELLA MIMIGARDEFORDENSIS DPN7 [TaxId:1247726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5af7b1, d5af7b2
  • Heterogens: FAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5af7A (A:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af7A (A:)
    eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
    lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
    isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
    itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalmsa
    ynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarlm
    lrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarmf
    tiaggtaqilrtqvaskildmklpqtrdgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5af7B (B:)
    myeltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvgg
    rglstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpa
    icisepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgig
    afitvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalm
    saynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaar
    lmlrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdar
    mftiaggtaqilrtqvaskildmklpqtrdgylkaaqnskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af7B (B:)
    eltpeqrtlqtqarelaqsvfastavqtdlteqypwdnvaqlrdagfmgmmlptsvggrg
    lstldtvivieemakacatmgritvdsnlgaigaitkygseeqiklaadlvlagdkpaic
    isepnagsaasemttradkngdhyilngekywitgggvsklhlifarvfddgveqgigaf
    itvlddhgpeglkvgrrlyamgvrgipethlefhdlkihksmmitfpdglkrgfaalmsa
    ynaqrvgagavalgiaqcafeegvaylkrreqfgrplaefqglqwmvadmsvqleaarlm
    lrsaavsgetfpdinkaaqakifaaetankvtndalqffgssgygrhnpmerhvrdarmf
    tiaggtaqilrtqvaskildmklpqtrdgyl